Thrombin Receptor/PAR1, Human (HEK293, His)
The thrombin receptor/PAR1 protein is a high-affinity receptor for activated thrombin that is coupled to G proteins to stimulate phosphoinositide hydrolysis. This signaling mechanism suggests its involvement in platelet activation, which is critical for hemostasis and thrombosis. Thrombin Receptor/PAR1 Protein, Human (HEK293, His) is the recombinant human-derived Thrombin Receptor/PAR1 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Thrombin Receptor/PAR1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/thrombin-receptor-par1-protein-human-hek293-his.html
Purity
95.00
Smiles
ARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
Molecular Formula
2149 (Gene_ID) P25116/NP_001983.2 (A22-T102) (Accession)
Molecular Weight
Approximately 22-37 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Goat Cysteine-rich hydrophobic domain 2 protein (CHIC2) ELISA Kit
Goat Cysteine-rich hydrophobic domain 2 protein (CHIC2) ELISA Kit
Goat Cysteine-rich hydrophobic domain 2 protein (CHIC2) ELISA Kit
Goat Cysteine-rich hydrophobic domain 2 protein (CHIC2) ELISA Kit
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJL152W (YJL152W)