Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (R23-K216) (Accession)

Molecular Weight

Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kir S, et al. FGF19 as a postprandial, insulin-independent activator of hepatic protein and glycogen synthesis. Science. 2011 Mar 25;331 (6024) :1621-4.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal CXCR3 Antibody (220803) [DyLight 594]
FAB1685M 0.1 mL

Rat Monoclonal CXCR3 Antibody (220803) [DyLight 594]

Ask
View Details
ATG4D (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (MaxLight 650)
MBS6220562-01 0.1 mL

ATG4D (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (MaxLight 650)

Ask
View Details
ATG4D (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (MaxLight 650)
MBS6220562-02 5x 0.1 mL

ATG4D (ATG4D, APG4D, AUTL4, Cysteine protease ATG4D, AUT-like 4 cysteine endopeptidase, Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D) (MaxLight 650)

Ask
View Details
General Cholesterol ELISA Kit
MBS9427718-01 96 Tests

General Cholesterol ELISA Kit

Ask
View Details
General Cholesterol ELISA Kit
MBS9427718-02 5x 96 Tests

General Cholesterol ELISA Kit

Ask
View Details
TMEM37 (NM_183240) Human Tagged ORF Clone
RG221482 10 µg

TMEM37 (NM_183240) Human Tagged ORF Clone

Ask
View Details