Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-19, Human

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Product Specifications

Product Name Alternative

FGF-19 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-19-protein-human.html

Purity

95.88

Smiles

RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Molecular Formula

9965 (Gene_ID) O95750 (R23-K216) (Accession)

Molecular Weight

Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Kir S, et al. FGF19 as a postprandial, insulin-independent activator of hepatic protein and glycogen synthesis. Science. 2011 Mar 25;331 (6024) :1621-4.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody
abx328219-01 50 µg

Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody

Ask
View Details
Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody
abx328219-02 100 µg

Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody

Ask
View Details
Porcine P Selectin PS ELISA Kit
BG-POR11816 1 Each

Porcine P Selectin PS ELISA Kit

Ask
View Details
PAI2, ID (Plasminogen Activator Inhibitor 2, PAI-2, Placental Plasminogen Activator Inhibitor, Monocyte Arg-serpin, Urokinase Inhibitor, Serpin B2, PLANH2, SERPINB2) (MaxLight 550) discontinued
P4256-30C-ML550 100 µL

PAI2, ID (Plasminogen Activator Inhibitor 2, PAI-2, Placental Plasminogen Activator Inhibitor, Monocyte Arg-serpin, Urokinase Inhibitor, Serpin B2, PLANH2, SERPINB2) (MaxLight 550) discontinued

Ask
View Details