Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurogenic locus notch homolog protein 1 (NOTCH1), partial

Product Specifications

Product Name Alternative

(Notch 1) (hN1) (Translocation-associated notch protein TAN-1)

Abbreviation

Recombinant Human NOTCH1 protein, partial

Gene Name

NOTCH1

UniProt

P46531

Expression Region

2428-2555aa

Organism

Homo sapiens (Human)

Target Sequence

HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4 (+) and CD8 (+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.7 kDa

References & Citations

"Integrin cytoplasmic domain-associated protein-1 attenuates sprouting angiogenesis." Brutsch R., Liebler S.S., Wustehube J., Bartol A., Herberich S.E., Adam M.G., Telzerow A., Augustin H.G., Fischer A. Circ. Res. 107:592-601 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cattle IL12A (Interleukin 12A) ELISA Kit
EK245321 96 Well

Cattle IL12A (Interleukin 12A) ELISA Kit

Sign In for Pricing
View Details
Mast Cell Tryptase Antibody / TPSAB1
R32453 100 µg

Mast Cell Tryptase Antibody / TPSAB1

Sign In for Pricing
View Details
Canine Relaxin, RLN ELISA Kit
MBS1604325-01 48 Well

Canine Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details
Canine Relaxin, RLN ELISA Kit
MBS1604325-02 96 Well

Canine Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details
Canine Relaxin, RLN ELISA Kit
MBS1604325-03 5x 96 Well

Canine Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details
Canine Relaxin, RLN ELISA Kit
MBS1604325-04 10x 96 Well

Canine Relaxin, RLN ELISA Kit

Sign In for Pricing
View Details