Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-42), (rat/mouse) (TFA)

β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Product Specifications

Product Name Alternative

Amyloid β-peptide (1-42) (rat/mouse) (TFA)

UNSPSC

12352209

Target

Amyloid-β

Type

Peptides

Related Pathways

Neuronal Signaling

Applications

Neuroscience-Neurodegeneration

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/_beta_-Amyloid__1-42_,_rat_TFA.html

Purity

98.26

Solubility

DMSO : 50 mg/mL (ultrasonic)

Smiles

[DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA(TFAsalt)]

Molecular Formula

C199H307N53O59S.xC2HF3O2

Molecular Weight

4418.02 (free acid)

References & Citations

[1]Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87 (6) :521-5.|[2]Lagunes T, et al. Abeta (1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86 (4) :1927-34.|[3]Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25 (18-19) :3186-94.|[4]Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42) -induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41 (2) :139-150.

Shipping Conditions

Blue Ice

Storage Conditions

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

Scientific Category

Peptides

Clinical Information

No Development Reported

Citation 01

Alzheimers Res Ther. 2025 Feb 1;17 (1) :35.|Aging Cell. 2025 Feb;24 (2) :e14374.|Bioorg Chem. 2024 Jun 22:150:107584.|Int Immunopharmacol. 2025 Sep 10:165:115526.|Patent. US20240335439A1.|Sci Rep. 2023 Aug 21;13 (1) :13586.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Corin ELISA Kit
GWB-SKR213 96 Tests

Human Corin ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (rCA8/8835) [DyLight 650]
NBP3-27031C 0.1 mL

Mouse Monoclonal Carbonic Anhydrase VIII/CA8 Antibody (rCA8/8835) [DyLight 650]

Sign In for Pricing
View Details
Recombinant Human IgG1 Fc/IGHG1 Protein
E53A05758 50 µg

Recombinant Human IgG1 Fc/IGHG1 Protein

Sign In for Pricing
View Details
Semen - Normal - 2. Ages 30-39 Years Old
MBS170568-01 1 Sample

Semen - Normal - 2. Ages 30-39 Years Old

Sign In for Pricing
View Details
Semen - Normal - 2. Ages 30-39 Years Old
MBS170568-02 5 Samples

Semen - Normal - 2. Ages 30-39 Years Old

Sign In for Pricing
View Details
Semen - Normal - 2. Ages 30-39 Years Old
MBS170568-03 5x 5 Samples

Semen - Normal - 2. Ages 30-39 Years Old

Sign In for Pricing
View Details