Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-42), (rat/mouse) (TFA)

β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Product Specifications

Product Name Alternative

Amyloid β-peptide (1-42) (rat/mouse) (TFA)

UNSPSC

12352209

Target

Amyloid-β

Type

Peptides

Related Pathways

Neuronal Signaling

Applications

Neuroscience-Neurodegeneration

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/_beta_-Amyloid__1-42_,_rat_TFA.html

Purity

98.26

Solubility

DMSO : 50 mg/mL (ultrasonic)

Smiles

[DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA(TFAsalt)]

Molecular Formula

C199H307N53O59S.xC2HF3O2

Molecular Weight

4418.02 (free acid)

References & Citations

[1]Mozes E, et al. A novel method for the rapid determination of beta-amyloid toxicity on acute hippocampal slices using MTT and LDH assays. Brain Res Bull. 2012 Apr 10;87 (6) :521-5.|[2]Lagunes T, et al. Abeta (1-42) induces abnormal alternative splicing of tau exons 2/3 in NGF-induced PC12 cells. An Acad Bras Cienc. 2014 Dec;86 (4) :1927-34.|[3]Stefania Sabella, et al. Capillary electrophoresis studies on the aggregation process of beta-amyloid 1-42 and 1-40 peptides. Electrophoresis. 2004 Oct;25 (18-19) :3186-94.|[4]Chennakesavan Karthick, et al. Time-dependent effect of oligomeric amyloid-β (1-42) -induced hippocampal neurodegeneration in rat model of Alzheimer's disease. Neurol Res. 2019 Feb;41 (2) :139-150.

Shipping Conditions

Blue Ice

Storage Conditions

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)

Scientific Category

Peptides

Clinical Information

No Development Reported

Citation 01

Alzheimers Res Ther. 2025 Feb 1;17 (1) :35.|Aging Cell. 2025 Feb;24 (2) :e14374.|Bioorg Chem. 2024 Jun 22:150:107584.|Int Immunopharmacol. 2025 Sep 10:165:115526.|Patent. US20240335439A1.|Sci Rep. 2023 Aug 21;13 (1) :13586.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FXYD1 (Ser83) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5348R-BF647 100 µL

Phospho-FXYD1 (Ser83) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Mouse Bcl2l15 qPCR Primer Pair
QM58982S 200 Tests

Mouse Bcl2l15 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human KDM7A shRNA (UAS) - Lentiviral human KDM7A shRNA (UAS, RFP) (100)
GTR15328971 1 Vial

Lentiviral human KDM7A shRNA (UAS) - Lentiviral human KDM7A shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MRPS15 Peptide - N-terminal region
MBS3229733-01 0.1 mg

MRPS15 Peptide - N-terminal region

Sign In for Pricing
View Details
MRPS15 Peptide - N-terminal region
MBS3229733-02 5x 0.1 mg

MRPS15 Peptide - N-terminal region

Sign In for Pricing
View Details
Rat Bcr Pre-designed siRNA Set A
SI201375A 1 Each

Rat Bcr Pre-designed siRNA Set A

Sign In for Pricing
View Details