GMP VEGF165, Human
GMP VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.
Product Specifications
Product Name Alternative
GMP VEGF165 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gmp-vegf165-protein-human.html
Purity
98.0
Smiles
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular Formula
7422 (Gene_ID) P15692-4 (A27-R191) (Accession)
Molecular Weight
Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940043-100 1x 100 µL
P21 / WAF1 (WA-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681074-100 1x 100 µL
SOX10 (SOX10/991 + SOX10/1074), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881234-500 1x 500 µL
Bcl-2 (100/D5 + 124), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940262-500 1x 500 µL
Human Lambda Light Chain (HP6054), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details