Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBEF1 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody against Visfatin 1

Product Specifications

Product Name Alternative

Anti-NAmPRTase antibody, anti-Nampt antibody, anti-NAMPT_HUMAN antibody, anti-Nicotinamide phosphoribosyltransferase antibody, anti-PBEF 1 antibody, anti-PBEF antibody, anti-PBEF1 antibody, anti-Pre B cell colony enhancing factor 1 antibody, anti-Pre B cell colony enhancing factor antibody, anti-Pre B cell enhancing factor antibody, anti-Pre-B cell-enhancing factor antibody, anti-Pre-B-cell colony-enhancing factor 1 antibody, anti-VF antibody, anti-Visfatin antibody, anti-Visfatin 1 antibody

UniProt

P43490

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1

Target

NAMPT

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL

Field of Research

Cardiovascular Research, Cell Biology, Disease Biomarkers, Epigenetics & Chromatin

Purification

Protein A purified

Concentration

1.0 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

54kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005737

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4R (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)
320194-01 50 µg

IL4R (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)

Sign In for Pricing
View Details
IL4R (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)
320194-02 100 µg

IL4R (IL4R, IL4RA, 582J2.1, Interleukin-4 receptor subunit alpha, IL-4 receptor subunit alpha, IL-4R subunit alpha, IL-4R-alpha, IL-4RA, CD antigen CD124)

Sign In for Pricing
View Details
Lentiviral mouse Gabpa shRNA (UAS) - Lentiviral mouse Gabpa shRNA (UAS, GFP) plasmid
GTR15210226 1 Vial

Lentiviral mouse Gabpa shRNA (UAS) - Lentiviral mouse Gabpa shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Caprisil C30 HPLC Column, 3 µm, 100 Å, CY533-C30 x 75 mm
CY333-C30 3 µm

Caprisil C30 HPLC Column, 3 µm, 100 Å, CY533-C30 x 75 mm

Sign In for Pricing
View Details
Rgc32 Protein Vector (Rat) (pPM-C-His)
PV298961 500 ng

Rgc32 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TMEM239 siRNA (Mouse)
MBS8218363-01 15 nmol

TMEM239 siRNA (Mouse)

Sign In for Pricing
View Details