Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O157:H7 Uncharacterized protein yqgB (yqgB)

Product Specifications

Abbreviation

Recombinant E.coli O157:H7 Uncharacterized protein yqgB protein

Gene Name

YqgB

UniProt

P64569

Expression Region

1-43aa

Organism

Escherichia coli O157:H7

Target Sequence

MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PIN1 sgRNA gene knockout kit - Lentiviral human PIN1 sgRNA gene knockout kit (25)
GTR15377229 1 Vial

Lentiviral human PIN1 sgRNA gene knockout kit - Lentiviral human PIN1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
1110034B05Rik 3'UTR Luciferase Stable Cell Line
TU100055 1.0 mL

1110034B05Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal PTF1A Antibody [Alexa Fluor 750]
NBP2-98726AF750 0.1 mL

Rabbit Polyclonal PTF1A Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
ACINUS, CT (Apoptotic Chromatin Condensation Inducer in the Nucleus, ACIN1, KIAA0670)
MBS645049-01 0.05 mg

ACINUS, CT (Apoptotic Chromatin Condensation Inducer in the Nucleus, ACIN1, KIAA0670)

Sign In for Pricing
View Details
ACINUS, CT (Apoptotic Chromatin Condensation Inducer in the Nucleus, ACIN1, KIAA0670)
MBS645049-02 5x 0.05 mg

ACINUS, CT (Apoptotic Chromatin Condensation Inducer in the Nucleus, ACIN1, KIAA0670)

Sign In for Pricing
View Details
FXYD1 Antibody, Biotin conjugated
A22574-50UG 50 µg

FXYD1 Antibody, Biotin conjugated

Sign In for Pricing
View Details