Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to SUV420H1

Product Specifications

Product Name Alternative

Anti CGI-85 antibody, anti CGI85 antibody, anti KMT5B antibody, anti MGC118906 antibody, anti MGC118909 antibody, anti MGC21161 antibody, anti MGC703 antibody

UniProt

B7WNX7

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1

Target

KMT5B

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: PVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNAS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

44kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057112

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vanilloid Receptor Like Protein 1 (Vanilloid Receptor-like Protein 1, VRL 1, VRL1, VRL-1, VRL, MGC12549, Osm 9 Like TRP Channel 2, Osm-9-like TRP Channel 2, OTRPC2, Stretch Activated Channel 2B, Stretch-activated Channel 2B, Sac2b, Transient Receptor Potential Cation Channel Subfamily V Member 2, TrpV2)
V2075-06 100 µg

Vanilloid Receptor Like Protein 1 (Vanilloid Receptor-like Protein 1, VRL 1, VRL1, VRL-1, VRL, MGC12549, Osm 9 Like TRP Channel 2, Osm-9-like TRP Channel 2, OTRPC2, Stretch Activated Channel 2B, Stretch-activated Channel 2B, Sac2b, Transient Receptor Potential Cation Channel Subfamily V Member 2, TrpV2)

Sign In for Pricing
View Details
CD316 (Immunoglobulin superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (AP) discontinued
124608-AP 100 µL

CD316 (Immunoglobulin superfamily member 8, CD81 partner 3, Glu-Trp-Ile EWI motif-containing protein 2, EWI-2, Keratinocytes-associated transmembrane protein 4, KCT-4, LIR-D1, IGSF8, CD81P3, EWI2, KCT4) (AP) discontinued

Sign In for Pricing
View Details
Anti-Kallikrein 11 Antibody, Rabbit Polyclonal
MBS8103840-01 0.1 mL

Anti-Kallikrein 11 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Kallikrein 11 Antibody, Rabbit Polyclonal
MBS8103840-02 5x 0.1 mL

Anti-Kallikrein 11 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
IFT46 Knockout NCI-H1975 Polyclonal Cells
ARG31706 1 Million

IFT46 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Anti-Elk1 (phospho-S383) Antibody
A01426S383-1 100 µL

Anti-Elk1 (phospho-S383) Antibody

Sign In for Pricing
View Details