Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Annexin A5/ANXA5, Human (solution)

Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1].

Product Specifications

Product Name Alternative

Annexin A5/ANXA5 Protein, Human (solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/annexin-a5-protein-human.html

Purity

95.10

Smiles

AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Molecular Formula

308 (Gene_ID) P08758 (A2-D320) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]Guochang Hu, et al. Recombinant human annexin A5: a novel drug candidate for treatment of sepsis? Crit Care Med. 2014 Jan;42 (1) :219-20.|[2]Ghita Ghislat, et al. Annexin A5 stimulates autophagy and inhibits endocytosis. J Cell Sci. 2012 Jan 1;125 (Pt 1) :92-107.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRATD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G5]
TA501922BM 100 µL

LRATD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G5]

Sign In for Pricing
View Details
IL8 (72aa)
MBS517110-01 0.025 mg

IL8 (72aa)

Sign In for Pricing
View Details
IL8 (72aa)
MBS517110-02 0.2 mg

IL8 (72aa)

Sign In for Pricing
View Details
IL8 (72aa)
MBS517110-03 1 mg

IL8 (72aa)

Sign In for Pricing
View Details
IL8 (72aa)
MBS517110-04 5x 1 mg

IL8 (72aa)

Sign In for Pricing
View Details
(2E) -3- (1,3-Benzodioxol-5-yl) -2-propenoic acid
262230-01 100 mg

(2E) -3- (1,3-Benzodioxol-5-yl) -2-propenoic acid

Sign In for Pricing
View Details