Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-beta/CXCL2, Human

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-beta/CXCL2 Protein, Human is produced in E. coli, and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-beta/CXCL2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-beta-cxcl2-protein-human.html

Purity

95.00

Smiles

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Molecular Formula

2920 (Gene_ID) P19875 (A35-N107) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Pelus LM, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[2]Al-Alwan LA, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[3]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[4]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[5]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[6]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[7]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse YM1/ECF-L/Chil3 Protein (His Tag)
PKSM040334 100 µg

Recombinant Mouse YM1/ECF-L/Chil3 Protein (His Tag)

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL
BNC400200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF580 Rabbit Polyclonal Antibody
TA370484 100 µL

ZNF580 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R1B Rabbit Polyclonal Antibody
TA366327 100 µL

PPP2R1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS703086 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Human SLC25A35 activation kit by CRISPRa
GA118242 1 Kit

Human SLC25A35 activation kit by CRISPRa

Sign In for Pricing
View Details