Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-beta/CXCL2, Human

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-beta/CXCL2 Protein, Human is produced in E. coli, and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-beta/CXCL2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-beta-cxcl2-protein-human.html

Purity

95.00

Smiles

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Molecular Formula

2920 (Gene_ID) P19875 (A35-N107) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Pelus LM, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[2]Al-Alwan LA, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[3]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[4]Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34 (8) :1010-20.|[5]Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32 (4) :353-68.|[6]Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55 (1) :48-55.|[7]Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-Itga5-3×HA-Neo Plasmid
PVT62739 2 µg

pCMV-Itga5-3×HA-Neo Plasmid

Sign In for Pricing
View Details
Rabbit Anti-SMC1B Polyclonal Antibody
PAV3718 100 μL

Rabbit Anti-SMC1B Polyclonal Antibody

Sign In for Pricing
View Details
KBTBD12 Antibody - N-terminal region : Biotin (ARP70618_P050-Biotin)
ARP70618_P050-Biotin 100 µL

KBTBD12 Antibody - N-terminal region : Biotin (ARP70618_P050-Biotin)

Sign In for Pricing
View Details
HRASLS5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0988907 1.0 µg DNA

HRASLS5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
IFN-γRα (2E2) Alexa Fluor® 790
sc-12753 AF790 200 µg/mL

IFN-γRα (2E2) Alexa Fluor® 790

Sign In for Pricing
View Details
2-Chloro-5- (pyrrolidine-1-sulfonyl) -pyridine
sc-274544 250 mg

2-Chloro-5- (pyrrolidine-1-sulfonyl) -pyridine

Sign In for Pricing
View Details