Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UL16-binding protein 1 (ULBP1) (Active)

Product Specifications

Product Name Alternative

(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)

Abbreviation

Recombinant Human ULBP1 protein (Active)

Gene Name

ULBP1

UniProt

Q9BZM6

Expression Region

26-216aa

Organism

Homo sapiens (Human)

Target Sequence

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Tag

C-terminal hFc1-Myc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml. ②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF740 conjugate, 0.1mg/mL
BNC742831-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF405S conjugate, 0.1mg/mL
BNC041706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GNAI3 (NM_006496) Human Over-expression Lysate
LC401948 20 µg

GNAI3 (NM_006496) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB607582 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704418 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
OR8G1 Antibody
8G686-AAT 50 µg

OR8G1 Antibody

Sign In for Pricing
View Details