Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 2 (Fgf2)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fgf2

UniProt

P15655

Expression Region

10-155aa

Organism

Mus musculus

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Tag

N-terminal 10xHis-tagged

Source

Yeast

Field of Research

Others

Assay Type

Developed Protein

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 . Also acts as an integrin ligand which is required for FGF2 signaling . Binds to integrin ITGAV:ITGB3 . Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration . Functions as a potent mitogen in vitro . Can induce angiogenesis . Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation .

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

References & Citations

Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCOA1 (NM_003743) Human Tagged ORF Clone
RC224812 10 µg

NCOA1 (NM_003743) Human Tagged ORF Clone

Sign In for Pricing
View Details
4-Carboxycinnamic acid
FC71077-01 10 g

4-Carboxycinnamic acid

Sign In for Pricing
View Details
4-Carboxycinnamic acid
FC71077-02 25 g

4-Carboxycinnamic acid

Sign In for Pricing
View Details
4-Carboxycinnamic acid
FC71077-03 50 g

4-Carboxycinnamic acid

Sign In for Pricing
View Details
4-Carboxycinnamic acid
FC71077-04 100 g

4-Carboxycinnamic acid

Sign In for Pricing
View Details
4-Carboxycinnamic acid
FC71077-05 250 g

4-Carboxycinnamic acid

Sign In for Pricing
View Details