Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 2 (Fgf2)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fgf2

UniProt

P15655

Expression Region

10-155aa

Organism

Mus musculus

Target Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Tag

N-terminal 10xHis-tagged

Source

Yeast

Field of Research

Others

Assay Type

Developed Protein

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 . Also acts as an integrin ligand which is required for FGF2 signaling . Binds to integrin ITGAV:ITGB3 . Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration . Functions as a potent mitogen in vitro . Can induce angiogenesis . Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation .

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

References & Citations

Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Seh1l (NM_028112) Mouse Tagged Lenti ORF Clone
MR218238L3 10 µg

Seh1l (NM_028112) Mouse Tagged Lenti ORF Clone

Ask
View Details
Hist1h2bf Mouse shRNA Plasmid (Locus ID 319180)
TL519823 1 Kit

Hist1h2bf Mouse shRNA Plasmid (Locus ID 319180)

Ask
View Details
Olfr30 (NM_146878) Mouse Tagged ORF Clone Lentiviral Particle
MR215129L3V 200 µL

Olfr30 (NM_146878) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
CBFB, ID (Core-binding Factor Subunit beta, CBF-beta, Polyomavirus Enhancer-binding Protein 2 beta Subunit, PEBP2-beta, PEA2-beta, SL3-3 Enhancer Factor 1 Subunit beta, SL3/AKV Core-binding Factor beta Subunit) (AP)
MBS6470277-01 0.2 mL

CBFB, ID (Core-binding Factor Subunit beta, CBF-beta, Polyomavirus Enhancer-binding Protein 2 beta Subunit, PEBP2-beta, PEA2-beta, SL3-3 Enhancer Factor 1 Subunit beta, SL3/AKV Core-binding Factor beta Subunit) (AP)

Ask
View Details
CBFB, ID (Core-binding Factor Subunit beta, CBF-beta, Polyomavirus Enhancer-binding Protein 2 beta Subunit, PEBP2-beta, PEA2-beta, SL3-3 Enhancer Factor 1 Subunit beta, SL3/AKV Core-binding Factor beta Subunit) (AP)
MBS6470277-02 5x 0.2 mL

CBFB, ID (Core-binding Factor Subunit beta, CBF-beta, Polyomavirus Enhancer-binding Protein 2 beta Subunit, PEBP2-beta, PEA2-beta, SL3-3 Enhancer Factor 1 Subunit beta, SL3/AKV Core-binding Factor beta Subunit) (AP)

Ask
View Details
VWF Antibody
MBS9631166-01 0.1 mL

VWF Antibody

Ask
View Details