Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interferon gamma (IFNG)

Product Specifications

Product Name Alternative

(IFN-gamma)

Abbreviation

Recombinant Cynomolgus monkey IFNG protein

Gene Name

IFNG

UniProt

P63309

Expression Region

24-165aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Signaling by an activated GPCR promotes GDP release and GTP binding. The alpha subunit has a low GTPase activity that converts bound GTP to GDP, thereby terminating the signal. Both GDP release and GTP hydrolysis are modulated by numerous regulatory proteins. Signaling is mediated via effector proteins, such as adenylate cyclase. Inhibits adenylate cyclase activity, leading to decreased intracellular cAMP levels. The inactive GDP-bound form prevents the association of RGS14 with centrosomes and is required for the translocation of RGS14 from the cytoplasm to the plasma membrane. Required for normal cytokinesis during mitosis. Required for cortical dynein-dynactin complex recruitment during metaphase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.7 kDa

References & Citations

"Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)
MBS1166896-01 0.02 mg (E-Coli)

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)
MBS1166896-02 0.02 mg (Yeast)

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)
MBS1166896-03 0.1 mg (E-Coli)

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)
MBS1166896-04 0.1 mg (Yeast)

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)
MBS1166896-05 0.02 mg (Baculovirus)

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)
MBS1166896-06 0.02 mg (Mammalian-Cell)

Recombinant Polaromonas naphthalenivorans Gamma-glutamyl phosphate reductase (proA)

Ask
View Details