Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Product Specifications

Product Name Alternative

ACP 2 Aspartate protease 2 Secreted aspartic protease 2

Abbreviation

Recombinant Candida albicans SAP2 protein

Gene Name

SAP2

UniProt

C4YMJ3

Expression Region

57-398aa

Organism

Candida albicans (strain WO-1) (Yeast)

Target Sequence

QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDNNEISLAQVKYTSASSISALT

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Miscellaneous Expressed both in W (white) and in O (opaque) cells of strain WO-1. Catalytic activity Preferential cleavage at the carboxyl of hydrophobic amino acids, but fails to cleave 15-Leu-|-Tyr-16, 16-Tyr-|-Leu-17 and 24-Phe-|-Phe-25 of insulin B chain. Activates trypsinogen, and degrades keratin. EC:3.4.23.24

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.1 kDa

References & Citations

"Three distinct secreted aspartyl proteinases in Candida albicans." White T.C., Miyasaki S.H., Agabian N. J. Bacteriol. 175:6126-6133 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grhl1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3734603 1.0 µg DNA

Grhl1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
KYNA (Kynurenic Acid) ELISA Kit
ELK8136-01 48 Tests

KYNA (Kynurenic Acid) ELISA Kit

Sign In for Pricing
View Details
KYNA (Kynurenic Acid) ELISA Kit
ELK8136-02 96 Tests

KYNA (Kynurenic Acid) ELISA Kit

Sign In for Pricing
View Details
KYNA (Kynurenic Acid) ELISA Kit
ELK8136-03 5x 96 Tests

KYNA (Kynurenic Acid) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Plastin L Antibody [FITC]
NBP2-99366F 0.1 mL

Rabbit Polyclonal Plastin L Antibody [FITC]

Sign In for Pricing
View Details
Mouse Monoclonal MBNL3 Antibody (PCRP-MBNL3-1D11) [DyLight 350]
NBP3-08663UV 100 µL

Mouse Monoclonal MBNL3 Antibody (PCRP-MBNL3-1D11) [DyLight 350]

Sign In for Pricing
View Details