Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100P, Human (His, solution)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His, solution) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100P Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100p-protein-human-his.html

Purity

93.45

Smiles

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Molecular Formula

6286 (Gene_ID) P25815 (M1-K95) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSDME Antibody, FITC conjugated
A19312-100UG 100 µg

GSDME Antibody, FITC conjugated

Sign In for Pricing
View Details
Human NPIPB6 siRNA
abx926252-01 15 nmol

Human NPIPB6 siRNA

Sign In for Pricing
View Details
Human NPIPB6 siRNA
abx926252-02 30 nmol

Human NPIPB6 siRNA

Sign In for Pricing
View Details
Rat Chemokine C C Motif Receptor 7 ELISA kit
GTR10417317 96 Well

Rat Chemokine C C Motif Receptor 7 ELISA kit

Sign In for Pricing
View Details
KIAA2013 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
25649061 1.0 µg DNA

KIAA2013 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Cytokeratin 7 antibody
10R-1826 100 ul

Cytokeratin 7 antibody

Sign In for Pricing
View Details