Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100P, Human (His, solution)

The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His, solution) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100P Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100p-protein-human-his.html

Purity

93.45

Smiles

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Molecular Formula

6286 (Gene_ID) P25815 (M1-K95) (Accession)

Molecular Weight

Approximately 12.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A1CF CytoSection
TS413415P5 25 Slides

A1CF CytoSection

Sign In for Pricing
View Details
RPS19BP1 ORF Vector (Human) (pORF)
42200011 1.0 µg DNA

RPS19BP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human Pleckstrin homology domain-containing family H member 1 (PLEKHH1) , partial
MBS1352776 Inquire

Recombinant Human Pleckstrin homology domain-containing family H member 1 (PLEKHH1) , partial

Sign In for Pricing
View Details
Syt8 ORF Vector (Mouse) (pORF)
ORF058970 1.0 µg DNA

Syt8 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal IgE Antibody (BE5) [PE/Atto594]
NB500-470PEATT594 0.1 mL

Mouse Monoclonal IgE Antibody (BE5) [PE/Atto594]

Sign In for Pricing
View Details
BTNL8, ID (BTNL8, Butyrophilin-like protein 8)
MBS6007574-01 0.2 mL

BTNL8, ID (BTNL8, Butyrophilin-like protein 8)

Sign In for Pricing
View Details