Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fractalkine/CX3CL1, Rat

Fractalkine/CX3CL1 protein is a versatile chemokine that acts as a ligand for CX3CR1 and integrins ITGAV:ITGB3 and ITGA4:ITGB1. It regulates immune response, inflammation, adhesion, and chemotaxis. It activates integrins via CX3CR1-dependent and -independent pathways, binding to site 1 with CX3CR1 and site 2 without CX3CR1. Soluble Fractalkine/CX3CL1 attracts T-cells and monocytes, not neutrophils. Fractalkine/CX3CL1 Protein, Rat is the recombinant rat-derived Fractalkine/CX3CL1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Fractalkine/CX3CL1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fractalkine-cx3cl1-protein-rat.html

Purity

98.0

Smiles

LAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG

Molecular Formula

89808 (Gene_ID) O55145 (L22-G100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog