Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACKR1, Human (Cell-Free, His)

ACKR3 is an atypical chemokine receptor that regulates chemokine levels and localization through high-affinity binding, induction of sequestration, degradation, or transcytosis. ACKR3, also known as a chemokine interceptor or decoy receptor, binds to chemokines such as CXCL11 and CXCL12/SDF1. ACKR1 Protein, Human (Cell-Free, His) is the recombinant human-derived ACKR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ACKR1 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ackr1-protein-human-his.html

Purity

85.00

Smiles

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

Molecular Formula

2532 (Gene_ID) Q16570-1 (M1-S336) (Accession)

Molecular Weight

42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB5B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV705603 1.0 µg DNA

RAB5B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
EGFR, Phosphorylated (Y1092) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 650)
MBS6415251-01 0.1 mL

EGFR, Phosphorylated (Y1092) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 650)

Sign In for Pricing
View Details
EGFR, Phosphorylated (Y1092) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 650)
MBS6415251-02 5x 0.1 mL

EGFR, Phosphorylated (Y1092) (Epidermal Growth Factor Receptor, ERBB, ERBB1, HER1, PIG61, MENA) (MaxLight 650)

Sign In for Pricing
View Details
GCP4 (TUBGCP4) Human Gene Knockout Kit (CRISPR)
KN400872 1 Kit

GCP4 (TUBGCP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytoglobin (D-7) HRP
sc-365246 HRP 200 µg/mL

Cytoglobin (D-7) HRP

Sign In for Pricing
View Details
Chicken Thromboxane A2 (TX-A2) ELISA Kit
NSL0129Ch 96 Tests

Chicken Thromboxane A2 (TX-A2) ELISA Kit

Sign In for Pricing
View Details