Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL11RA Antibody
E19-4705 100 µg -100 µL

IL11RA Antibody

Sign In for Pricing
View Details
Aqp1 (NM_012778) Rat Tagged ORF Clone Lentiviral Particle
RR203590L3V 200 µL

Aqp1 (NM_012778) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cow Cathelicidin 1 (CATHL1) ELISA Kit
abx520922 96 Tests

Cow Cathelicidin 1 (CATHL1) ELISA Kit

Sign In for Pricing
View Details
AGRN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0059507 1.0 µg DNA

AGRN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TRNAQ51P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV753661 1.0 µg DNA

TRNAQ51P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Human Aldolase (ALD) ELISA Kit
MBS2800252-01 48 Tests

Human Aldolase (ALD) ELISA Kit

Sign In for Pricing
View Details