Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii ycaR Protein (aa 1-60) (strain CDC 3083-94 / BS512)
VAng-Lsx08938-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii ycaR Protein (aa 1-60) (strain CDC 3083-94 / BS512)

Sign In for Pricing
View Details
Pef1 Mouse qPCR Template Standard (NM_026441)
MK201647 1 Kit

Pef1 Mouse qPCR Template Standard (NM_026441)

Sign In for Pricing
View Details
Phospho-Wee1 (Ser123) Polyclonal Antibody, Cy5 Conjugated
bs-5218R-Cy5 100 µL

Phospho-Wee1 (Ser123) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
RFTN1 siRNA (Human)
CRH8063-01 15 nmol

RFTN1 siRNA (Human)

Sign In for Pricing
View Details
RFTN1 siRNA (Human)
CRH8063-02 30 nmol

RFTN1 siRNA (Human)

Sign In for Pricing
View Details
Sulfite oxidase Antibody (Biotin)
KB-12208-01 50 μL

Sulfite oxidase Antibody (Biotin)

Sign In for Pricing
View Details