Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3-kinase p85β shRNA (r) Lentiviral Particles
sc-156022-V 200 µL

PI 3-kinase p85β shRNA (r) Lentiviral Particles

Sign In for Pricing
View Details
CDK2AP1 (NM_004642) Human Over-expression Lysate
LC401472 20 µg

CDK2AP1 (NM_004642) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP4F3, NT (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B(4) omega-hydroxylase 2, Leukotriene-B(4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) (APC)
MBS6471713-01 0.2 mL

CYP4F3, NT (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B(4) omega-hydroxylase 2, Leukotriene-B(4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) (APC)

Sign In for Pricing
View Details
CYP4F3, NT (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B(4) omega-hydroxylase 2, Leukotriene-B(4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) (APC)
MBS6471713-02 5x 0.2 mL

CYP4F3, NT (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B(4) omega-hydroxylase 2, Leukotriene-B(4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) (APC)

Sign In for Pricing
View Details
HRP2 (HRPII, Histidine-rich protein 2, Malaria Histidine-rich protein 2, Malaria HRP2) (Biotin)
226999-Biotin 100 µL

HRP2 (HRPII, Histidine-rich protein 2, Malaria Histidine-rich protein 2, Malaria HRP2) (Biotin)

Sign In for Pricing
View Details
Ceramide synthase 2 (CERS2) (NM_022075) Human Tagged ORF Clone Lentiviral Particle
RC200145L3V 200 µL

Ceramide synthase 2 (CERS2) (NM_022075) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details