Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CNTNAP2/CASPR2 Protein (His Tag)
PKSM040564 100 µg

Recombinant Mouse CNTNAP2/CASPR2 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Anti Pig CD4: FITC
MBS225685-01 0.1 mg

Mouse Anti Pig CD4: FITC

Sign In for Pricing
View Details
Mouse Anti Pig CD4: FITC
MBS225685-02 5x 0.1 mg

Mouse Anti Pig CD4: FITC

Sign In for Pricing
View Details
Rabbit Polyclonal Cathepsin Z Antibody [DyLight 755]
NBP3-06499IR 0.1 mL

Rabbit Polyclonal Cathepsin Z Antibody [DyLight 755]

Sign In for Pricing
View Details
pLV2-U6-FGFR1-shRNA1-PGK-Puro Plasmid
PVT55023 2 µg

pLV2-U6-FGFR1-shRNA1-PGK-Puro Plasmid

Sign In for Pricing
View Details
SIRT1 (Sirtuin (Silent Mating Type Information Regulation 2 Homolog) 1 (S. cerevisiae), SIR2L1) (Biotin)
251673-Biotin 100 µL

SIRT1 (Sirtuin (Silent Mating Type Information Regulation 2 Homolog) 1 (S. cerevisiae), SIR2L1) (Biotin)

Sign In for Pricing
View Details