Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT4 (Synaptotagmin IV, HsT1192, KIAA1342)
252325 200 µL

SYT4 (Synaptotagmin IV, HsT1192, KIAA1342)

Sign In for Pricing
View Details
Lentiviral human KCNC2 shRNA (UAS) - Lentiviral human KCNC2 shRNA (UAS, iRFP) (100)
GTR15081531 1 Vial

Lentiviral human KCNC2 shRNA (UAS) - Lentiviral human KCNC2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal GAT3 Antibody
NBP2-97671-50ul 50 µL

Rabbit Polyclonal GAT3 Antibody

Sign In for Pricing
View Details
Ssb 3'UTR Luciferase Stable Cell Line
TU119727 1.0 mL

Ssb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse Angptl4 Protein, Fc Tag
MOP2070 50 µg

Recombinant Mouse Angptl4 Protein, Fc Tag

Sign In for Pricing
View Details
Lentiviral mouse Cacng5 shRNA (UAS) - Lentiviral mouse Cacng5 shRNA (UAS, iRFP) (100)
GTR15261471 1 Vial

Lentiviral mouse Cacng5 shRNA (UAS) - Lentiviral mouse Cacng5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details