Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARX1 Protein Vector (Human) (pPB-N-His)
PV003502 500 ng

BARX1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Sytl3 (NM_031395) Mouse Tagged ORF Clone Lentiviral Particle
MR217944L4V 200 µL

Sytl3 (NM_031395) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ankef1 (NM_175667) Mouse Tagged ORF Clone Lentiviral Particle
MR219992L4V 200 µL

Ankef1 (NM_175667) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tcl1b1 (NM_013773) Mouse Tagged ORF Clone Lentiviral Particle
MR200493L3V 200 µL

Tcl1b1 (NM_013773) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Polyclonal CCR8 Antibody (N-Terminus)
APR11026G 0.05mg

Polyclonal CCR8 Antibody (N-Terminus)

Sign In for Pricing
View Details
Human SMU1 qPCR Primer Pair
QH44525S 200 Tests

Human SMU1 qPCR Primer Pair

Sign In for Pricing
View Details