Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1700023F06Rik shRNA (UAS) - Lentiviral mouse 1700023F06Rik shRNA (UAS) plasmid
GTR15139675 1 Vial

Lentiviral mouse 1700023F06Rik shRNA (UAS) - Lentiviral mouse 1700023F06Rik shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Anti-phospho-Nephrin (Tyr1217) antibody
SL19199R-01 50 µL

Rabbit Anti-phospho-Nephrin (Tyr1217) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-Nephrin (Tyr1217) antibody
SL19199R-02 100 µL

Rabbit Anti-phospho-Nephrin (Tyr1217) antibody

Sign In for Pricing
View Details
Lentiviral mouse Tbca shRNA (UAS) - Lentiviral mouse Tbca shRNA (UAS, RFP) plasmid
GTR15146917 1 Vial

Lentiviral mouse Tbca shRNA (UAS) - Lentiviral mouse Tbca shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Prostaglandin D2 Receptor 2 (PTGDR2) Antibody (APC)
abx347229 100 Tests

Prostaglandin D2 Receptor 2 (PTGDR2) Antibody (APC)

Sign In for Pricing
View Details
Peroxin 5 (m) : 293T Lysate
sc-110429 100 µg - 200 µL

Peroxin 5 (m) : 293T Lysate

Sign In for Pricing
View Details