Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAQR6, CT (PAQR6, Progestin and adipoQ receptor family member 6, Progestin and adipoQ receptor family member VI) (MaxLight 490) discontinued
039649-ML490 100 µL

PAQR6, CT (PAQR6, Progestin and adipoQ receptor family member 6, Progestin and adipoQ receptor family member VI) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rapsyn (RAPSN) (NM_005055) Human Over-expression Lysate
LC417541 20 µg

Rapsyn (RAPSN) (NM_005055) Human Over-expression Lysate

Sign In for Pricing
View Details
Ing5 (BC064674) Mouse Untagged Clone
MC206898 10 µg

Ing5 (BC064674) Mouse Untagged Clone

Sign In for Pricing
View Details
Klk1b1 ORF Vector (Mouse) (pORF)
ORF048701 1.0 µg DNA

Klk1b1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZFP64 Polyclonal Antibody
MBS2562150-01 0.02 mL

ZFP64 Polyclonal Antibody

Sign In for Pricing
View Details
ZFP64 Polyclonal Antibody
MBS2562150-02 0.06 mL

ZFP64 Polyclonal Antibody

Sign In for Pricing
View Details