CD83, Rat (HEK293, His)
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD83 Protein, Rat (HEK293, His), Rat, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html
Purity
96.0
Smiles
MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA
Molecular Formula
361226 (Gene_ID) A6J740 (M22-A134) (Accession)
Molecular Weight
Approximately 27-35 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PI3KC3, CT (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34, PI 3 Kinase Class 3) (APC)
PI3KC3, CT (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34, PI 3 Kinase Class 3) (APC)
Lentiviral mouse Cinp shRNA (UAS) - Lentiviral mouse Cinp shRNA (UAS, GFP) (100)
Recombinant EBOV GP Protein (aa 1-650) [His] (HEK293 Cells)
