Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-TIMP3 Plasmid
PVT27311 2 µg

pOTB7-TIMP3 Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Samt3 shRNA (UAS) - Lentiviral mouse Samt3 shRNA (UAS, iRFP) (100)
GTR15256875 1 Vial

Lentiviral mouse Samt3 shRNA (UAS) - Lentiviral mouse Samt3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal PARL Antibody [DyLight 405]
NBP1-76938V 0.1 mL

Rabbit Polyclonal PARL Antibody [DyLight 405]

Sign In for Pricing
View Details
MLF2 (Myeloid Leukemia Factor 2, Myelodysplasia-myeloid Leukemia Factor 2, NTN4) (MaxLight 750) discontinued
129718-ML750 100 µL

MLF2 (Myeloid Leukemia Factor 2, Myelodysplasia-myeloid Leukemia Factor 2, NTN4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human AMT Protein Lysate
MBS137188-01 0.02 mg

Human AMT Protein Lysate

Sign In for Pricing
View Details
Human AMT Protein Lysate
MBS137188-02 5x 0.02 mg

Human AMT Protein Lysate

Sign In for Pricing
View Details