Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMO Antibody / Kynurenine 3 monooxygenase
F54990-0.08ML 0.08 mL

KMO Antibody / Kynurenine 3 monooxygenase

Sign In for Pricing
View Details
Lentiviral mouse Kif9 shRNA (UAS) - Lentiviral mouseKif9 shRNA (UAS, GFP) (25)
GTR15184844 1 Vial

Lentiviral mouse Kif9 shRNA (UAS) - Lentiviral mouseKif9 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
(25S) -3alpha,7alpha,12alpha-Trihydroxy-5beta-cholestanoyl-CoA
HY-CE00074 1 Each

(25S) -3alpha,7alpha,12alpha-Trihydroxy-5beta-cholestanoyl-CoA

Sign In for Pricing
View Details
Sheep Androstenone (ADT) ELISA Kit
YP-W74969-01 48 Tests

Sheep Androstenone (ADT) ELISA Kit

Sign In for Pricing
View Details
Sheep Androstenone (ADT) ELISA Kit
YP-W74969-02 96 Tests

Sheep Androstenone (ADT) ELISA Kit

Sign In for Pricing
View Details
SH3PXD2B Antibody
DF13894-01 100 µL

SH3PXD2B Antibody

Sign In for Pricing
View Details