Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r65 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
49809064 1.0 µg DNA

Vmn2r65 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CTBP2 (NM_001083914) Human Tagged Lenti ORF Clone
RC213339L4 10 µg

CTBP2 (NM_001083914) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CTLA-4 (F-8) HRP
sc-376016 HRP 200 µg/mL

CTLA-4 (F-8) HRP

Sign In for Pricing
View Details
Hepatitis C Virus NS4 protein
30-AH60 200 ug

Hepatitis C Virus NS4 protein

Sign In for Pricing
View Details
Mouse Monoclonal IL-2 R beta Antibody (03) [mFluor Violet 500 SE]
NBP3-30744MFV500 0.1 mL

Mouse Monoclonal IL-2 R beta Antibody (03) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Mertk (NM_008587) Mouse Tagged ORF Clone Lentiviral Particle
MR225392L3V 200 µL

Mertk (NM_008587) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details