Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 siRNA (Human)
MBS8213196-01 15 nmol

MCM7 siRNA (Human)

Sign In for Pricing
View Details
MCM7 siRNA (Human)
MBS8213196-02 30 nmol

MCM7 siRNA (Human)

Sign In for Pricing
View Details
MCM7 siRNA (Human)
MBS8213196-03 5x 30 nmol

MCM7 siRNA (Human)

Sign In for Pricing
View Details
Lentiviral mouse Gtf2f1 shRNA (UAS) - Lentiviral mouse Gtf2f1 shRNA (UAS, GFP) (100)
GTR15287649 1 Vial

Lentiviral mouse Gtf2f1 shRNA (UAS) - Lentiviral mouse Gtf2f1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Human SIRPA protein, N-His-SUMO Tag
IMP-1478 20 µg

Recombinant Human SIRPA protein, N-His-SUMO Tag

Sign In for Pricing
View Details
OSCAR (NM_133169) Human Over-expression Lysate
LC403334 20 µg

OSCAR (NM_133169) Human Over-expression Lysate

Sign In for Pricing
View Details