Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TLK2 Antibody [Alexa Fluor 700]
NBP2-99818AF700 0.1 mL

Rabbit Polyclonal TLK2 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Connexin 40.1 (GJD4) Human shRNA Plasmid Kit (Locus ID 219770)
TL307684 1 Kit

Connexin 40.1 (GJD4) Human shRNA Plasmid Kit (Locus ID 219770)

Sign In for Pricing
View Details
Elephant Progesterone (PROG) ELISA Kit
QY-E180001 96 Tests

Elephant Progesterone (PROG) ELISA Kit

Sign In for Pricing
View Details
N-Sulphamyl-3-chloropropionamidine Hydrochloride
TRC-N223595-500MG 500 mg

N-Sulphamyl-3-chloropropionamidine Hydrochloride

Sign In for Pricing
View Details
Mouse Monoclonal TAG-72 Antibody (rTAG72/9132) [Alexa Fluor 488]
NBP3-23987AF488 0.1 mL

Mouse Monoclonal TAG-72 Antibody (rTAG72/9132) [Alexa Fluor 488]

Sign In for Pricing
View Details
CCER1 (NM_152638) Human Tagged ORF Clone
RC205408 10 µg

CCER1 (NM_152638) Human Tagged ORF Clone

Sign In for Pricing
View Details