Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Histone H2B type 1-C/E/F/G/I polyclonal Antibody
MBS715401-01 0.05 mg

Rabbit anti-human Histone H2B type 1-C/E/F/G/I polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Histone H2B type 1-C/E/F/G/I polyclonal Antibody
MBS715401-02 0.1 mg

Rabbit anti-human Histone H2B type 1-C/E/F/G/I polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Histone H2B type 1-C/E/F/G/I polyclonal Antibody
MBS715401-03 5x 0.1 mg

Rabbit anti-human Histone H2B type 1-C/E/F/G/I polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human PGBD2 shRNA (UAS) - Lentiviral human PGBD2 shRNA (UAS) plasmid
GTR15138919 1 Vial

Lentiviral human PGBD2 shRNA (UAS) - Lentiviral human PGBD2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
1H-Isoindole-4-carboxylic acid, 2- (2,6-dioxo-3-piperidinyl) -2,3-dihydro-1,3-dioxo-
JH919825 1 Each

1H-Isoindole-4-carboxylic acid, 2- (2,6-dioxo-3-piperidinyl) -2,3-dihydro-1,3-dioxo-

Sign In for Pricing
View Details
Steap1 Mouse qPCR Primer Pair (NM_027399)
MP215513 200 Reactions

Steap1 Mouse qPCR Primer Pair (NM_027399)

Sign In for Pricing
View Details