Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCP6 HDR Plasmid (h)
sc-410212-HDR 20 µg

CCP6 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Protoheme IX farnesyltransferase (ctaB1), partial
MBS7075234 Inquire

Recombinant Nitrobacter hamburgensis Protoheme IX farnesyltransferase (ctaB1), partial

Sign In for Pricing
View Details
SSX2 (NM_175698) Human Recombinant Protein
TP303504 20 µg

SSX2 (NM_175698) Human Recombinant Protein

Sign In for Pricing
View Details
Olr836 (NM_001000406) Rat Tagged ORF Clone Lentiviral Particle
RR215541L3V 200 µL

Olr836 (NM_001000406) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AARE (APEH) Human siRNA Oligo Duplex (Locus ID 327)
SR300229 1 Kit

AARE (APEH) Human siRNA Oligo Duplex (Locus ID 327)

Sign In for Pricing
View Details
Srek1 Rat shRNA Lentiviral Particle (Locus ID 56763)
TL710406V 500 µL Each

Srek1 Rat shRNA Lentiviral Particle (Locus ID 56763)

Sign In for Pricing
View Details