Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTT1, NT (GSTT1, Glutathione S-transferase theta-1, GST class-theta-1, Glutathione transferase T1-1) (MaxLight 750)
MBS6304765-01 0.1 mL

GSTT1, NT (GSTT1, Glutathione S-transferase theta-1, GST class-theta-1, Glutathione transferase T1-1) (MaxLight 750)

Sign In for Pricing
View Details
GSTT1, NT (GSTT1, Glutathione S-transferase theta-1, GST class-theta-1, Glutathione transferase T1-1) (MaxLight 750)
MBS6304765-02 5x 0.1 mL

GSTT1, NT (GSTT1, Glutathione S-transferase theta-1, GST class-theta-1, Glutathione transferase T1-1) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Monoclonal 5'-Nucleotidase/CD73 Antibody (102) [DyLight 350]
NBP2-89706UV 0.1 mL

Rabbit Monoclonal 5'-Nucleotidase/CD73 Antibody (102) [DyLight 350]

Sign In for Pricing
View Details
ATG7 Knockout HAP1 Polyclonal Cells
ARG27332 1 Million

ATG7 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Human DDIAS qPCR Primer Pair
QH68709S 200 Tests

Human DDIAS qPCR Primer Pair

Sign In for Pricing
View Details
Nox4 ORF Vector (Mouse) (pORF)
ORF051547 1.0 µg DNA

Nox4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details