Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD83, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD83 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd83-protein-rat-hek293-his.html

Purity

96.0

Smiles

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Molecular Formula

361226 (Gene_ID) A6J740 (M22-A134) (Accession)

Molecular Weight

Approximately 27-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EFCAB10 Antibody (R4D49)
RHP10601 100 μg

Anti-EFCAB10 Antibody (R4D49)

Sign In for Pricing
View Details
EZSolution™ Tandutinib
B2627-5 5 mg

EZSolution™ Tandutinib

Sign In for Pricing
View Details
1700028K03Rik ORF Vector (Mouse) (pORF)
ORF036784 1.0 µg DNA

1700028K03Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ARL2BP Protein Vector (Mouse) (pPB-C-His)
PV156146 500 ng

ARL2BP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human SIGLECL1 Pre-designed siRNA Set A
SI014783A 1 Each

Human SIGLECL1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Tiprl (NM_001109667) Rat Tagged ORF Clone Lentiviral Particle
RR211522L3V 200 µL

Tiprl (NM_001109667) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details