Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLGF-2, Human (HEK293, His)

The PLGF-2 protein is a key growth factor for angiogenesis and endothelial cell growth, crucially stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor. It coordinates the angiogenic process, regulates blood vessel growth, and exhibits additional binding capabilities to NRP1/neuropilin-1 and NRP2/neuropilin-2. PLGF-2 Protein, Human (HEK293, His) is the recombinant human-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLGF-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plgf-2-protein-human-hek-293-his.html

Purity

95.0

Smiles

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Molecular Formula

5228 (Gene_ID) P49763-3 (L19-R170) (Accession)

Molecular Weight

Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Small Ubiquitin Related Modifier Protein 2 (SUMO2) ELISA Kit
DLR-SUMO2-Hu-48T 48 Tests

Human Small Ubiquitin Related Modifier Protein 2 (SUMO2) ELISA Kit

Sign In for Pricing
View Details
Angiomotin (AMOT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F9]
TA507142AM 100 µL

Angiomotin (AMOT) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F9]

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2128037-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2128037-02 0.2 mL

Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2128037-03 0.5 mL

Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2128037-04 1 mL

Cy3 Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details