Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFCP2L1 Protein Vector (Mouse) (pPM-C-HA)
46565024 500 ng

TFCP2L1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Edil3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3903908 1.0 µg DNA

Edil3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Scn5a (NM_021544) Mouse Untagged Clone
MC225126 10 µg

Scn5a (NM_021544) Mouse Untagged Clone

Sign In for Pricing
View Details
EMR2 (ADGRE2) (NM_013447) Human Untagged Clone
SC115222 10 µg

EMR2 (ADGRE2) (NM_013447) Human Untagged Clone

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Monkey IgM Secondary Antibody [Allophycocyanin/Cy7]
NBP2-59719APCCY7 0.5 mL

Goat Polyclonal Goat anti-Monkey IgM Secondary Antibody [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Recombinant Human Crystallin Lambda 1 (CRYl1)
RPU41039-01 50 µg

Recombinant Human Crystallin Lambda 1 (CRYl1)

Sign In for Pricing
View Details