Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPFIA1 Pre-designed siRNA Set B
SI012614B 1 Each

Human PPFIA1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse EB IgA ELISA Kit
EME0012 96 Tests

Mouse EB IgA ELISA Kit

Sign In for Pricing
View Details
phoA Rabbit Polyclonal Antibody
AP21367AF-N 10 mg

phoA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
YIF1B (NM_001145463) Human Untagged Clone
SC326549 10 µg

YIF1B (NM_001145463) Human Untagged Clone

Sign In for Pricing
View Details
PLV-EF1a-CA3-IRES-BSD Plasmid
PVT81181 2 µg

PLV-EF1a-CA3-IRES-BSD Plasmid

Sign In for Pricing
View Details
ROCK1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62969R-BF555 100 µL

ROCK1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details