Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxyfasudil 10mM * 1mL in DMSO
A15118-10mM-D 10 mM x 1mL in DMSO

Hydroxyfasudil 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Mena discontinued
344331-01 100 µL

Mena discontinued

Sign In for Pricing
View Details
Mena discontinued
344331-02 200 µL

Mena discontinued

Sign In for Pricing
View Details
CMG1 (IFT74) Rabbit Polyclonal Antibody
TA308304 100 µL

CMG1 (IFT74) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRI3 (Brain Protein I3)
476373 100 µL

BRI3 (Brain Protein I3)

Sign In for Pricing
View Details
Zfp787 CRISPRa sgRNA lentivector (set of three targets)(Rat)
51132126 3x 1.0µg DNA

Zfp787 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details