Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPA Over-expression Lysate Product
GWB-83CF4F 0.1 mg

CENPA Over-expression Lysate Product

Sign In for Pricing
View Details
PRRT1 Protein Vector (Mouse) (pPB-C-His)
PV219962 500 ng

PRRT1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat Prcp (Prolylcarboxypeptidase) ELISA Kit
FY-ER5014 96 Well

Rat Prcp (Prolylcarboxypeptidase) ELISA Kit

Sign In for Pricing
View Details
(2Z) -1-Chloro-2-decene
422232-01 2.5 mg

(2Z) -1-Chloro-2-decene

Sign In for Pricing
View Details
(2Z) -1-Chloro-2-decene
422232-02 5 mg

(2Z) -1-Chloro-2-decene

Sign In for Pricing
View Details
SHC1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV785736 1.0 µg DNA

SHC1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details