Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PLA2G12A Protein, N-His
HV099012-01 50 µg

Recombinant Human PLA2G12A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PLA2G12A Protein, N-His
HV099012-02 100 µg

Recombinant Human PLA2G12A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PLA2G12A Protein, N-His
HV099012-03 1 mg

Recombinant Human PLA2G12A Protein, N-His

Sign In for Pricing
View Details
Anti-NLN Rabbit pAb
GB115031-50 50 μL

Anti-NLN Rabbit pAb

Sign In for Pricing
View Details
AK3 Mouse Monoclonal Antibody [Clone ID: SJB3-36]
SM6029S 50 µL

AK3 Mouse Monoclonal Antibody [Clone ID: SJB3-36]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]
RD30750F-01 25 µg

PE/Cyanine7 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details