Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSNARE1 AAV Vector (Human) (CMV)
48574102 1 µg

TSNARE1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
hsa-miR-585-5p miRNA Mimic
MCH03176 2x 2.5 nmol

hsa-miR-585-5p miRNA Mimic

Sign In for Pricing
View Details
Ascorbic Acid (AsA) Assay Kit
E47S120 100 Tests - 96 Samples

Ascorbic Acid (AsA) Assay Kit

Sign In for Pricing
View Details
KIR2DL2 Human siRNA Oligo Duplex (Locus ID 3803)
SR320787 1 Kit

KIR2DL2 Human siRNA Oligo Duplex (Locus ID 3803)

Sign In for Pricing
View Details
Recombinant Human Zinc Finger Protein 514
MBS145872-01 0.005 mg

Recombinant Human Zinc Finger Protein 514

Sign In for Pricing
View Details
Recombinant Human Zinc Finger Protein 514
MBS145872-02 0.02 mg

Recombinant Human Zinc Finger Protein 514

Sign In for Pricing
View Details