Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-F3 (HuMab-TF-011)-Mc-MMAF ADC
ADC-W-045 1 mg

Anti-F3 (HuMab-TF-011)-Mc-MMAF ADC

Sign In for Pricing
View Details
Lentiviral mouse L3mbtl3 shRNA (UAS) - Lentiviral mouse L3mbtl3 shRNA (UAS, iRFP) (100)
GTR15238095 1 Vial

Lentiviral mouse L3mbtl3 shRNA (UAS) - Lentiviral mouse L3mbtl3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Kif1c (NM_153103) Mouse Untagged Clone
MC223545 10 µg

Kif1c (NM_153103) Mouse Untagged Clone

Sign In for Pricing
View Details
CD11b (Mac-1, alphaM integrin, Cr3, MO-1, C3bi Receptor) (Azide Free) discontinued
C2262-40R 500 µg

CD11b (Mac-1, alphaM integrin, Cr3, MO-1, C3bi Receptor) (Azide Free) discontinued

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Deoxythymidine Monophosphate (dTMP)
MBS2120433-01 0.1 mL

APC-Linked Polyclonal Antibody to Deoxythymidine Monophosphate (dTMP)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Deoxythymidine Monophosphate (dTMP)
MBS2120433-02 0.2 mL

APC-Linked Polyclonal Antibody to Deoxythymidine Monophosphate (dTMP)

Sign In for Pricing
View Details