Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhl29 Rat shRNA Plasmid (Locus ID 298867)
TR705288 1 Kit

Klhl29 Rat shRNA Plasmid (Locus ID 298867)

Sign In for Pricing
View Details
Rabbit Polyclonal ZMAT5 Antibody
NBP1-85794 0.1 mL

Rabbit Polyclonal ZMAT5 Antibody

Sign In for Pricing
View Details
Cariprazine hydrochloride 50mg
A15036-50 50 mg

Cariprazine hydrochloride 50mg

Sign In for Pricing
View Details
Rabbit Polyclonal FAM43B Antibody [DyLight 594]
NBP3-05973DL594 0.1 mL

Rabbit Polyclonal FAM43B Antibody [DyLight 594]

Sign In for Pricing
View Details
Recombinant Human HMGB1 Protein
MBS8249158-01 0.01 mg

Recombinant Human HMGB1 Protein

Sign In for Pricing
View Details
Recombinant Human HMGB1 Protein
MBS8249158-02 0.05 mg

Recombinant Human HMGB1 Protein

Sign In for Pricing
View Details