Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMS-309403
GW9859-25mg 25 mg

BMS-309403

Sign In for Pricing
View Details
Rabbit anti-human Peptide YY polyclonal Antibody, HRP conjugated
MBS719519-01 0.05 mg

Rabbit anti-human Peptide YY polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Peptide YY polyclonal Antibody, HRP conjugated
MBS719519-02 0.1 mg

Rabbit anti-human Peptide YY polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Peptide YY polyclonal Antibody, HRP conjugated
MBS719519-03 5x 0.1 mg

Rabbit anti-human Peptide YY polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Gag-Pol antibody (FITC)
MBS838902-01 0.1 mg

Gag-Pol antibody (FITC)

Sign In for Pricing
View Details
Gag-Pol antibody (FITC)
MBS838902-02 5x 0.1 mg

Gag-Pol antibody (FITC)

Sign In for Pricing
View Details