Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uba6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6451007 1.0 µg DNA

Uba6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
RPL17P23 AAV Vector (Human) (CMV)
40886101 1 µg

RPL17P23 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
FGFRL1 Human shRNA Plasmid Kit (Locus ID 53834)
TL312986 1 Kit

FGFRL1 Human shRNA Plasmid Kit (Locus ID 53834)

Sign In for Pricing
View Details
Cynomolgus_TPBG (5T4) CHO-K1 Cell Line
ABC-X0389F 1 Vial

Cynomolgus_TPBG (5T4) CHO-K1 Cell Line

Sign In for Pricing
View Details
Lentiviral human CCDC63 shRNA (UAS) - Lentiviral human CCDC63 shRNA (UAS, GFP) (100)
GTR15320976 1 Vial

Lentiviral human CCDC63 shRNA (UAS) - Lentiviral human CCDC63 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-ANXA1/Annexin A1 Antibody (R2Y54)
RHC06205 100 μg

Anti-ANXA1/Annexin A1 Antibody (R2Y54)

Sign In for Pricing
View Details