Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EphA1 Antibody
NBP2-16345 0.1 mL

Rabbit Polyclonal EphA1 Antibody

Sign In for Pricing
View Details
Usf1 3'UTR GFP Stable Cell Line
TU272909 1.0 mL

Usf1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TTC28 Protein Vector (Mouse) (pPM-C-HA)
PV242688 500 ng

TTC28 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TBL2 rabbit pAb
ES5505-01 50 µL

TBL2 rabbit pAb

Sign In for Pricing
View Details
TBL2 rabbit pAb
ES5505-02 100 µL

TBL2 rabbit pAb

Sign In for Pricing
View Details
anti-RFC4
YF-PA14356 50 ug

anti-RFC4

Sign In for Pricing
View Details