Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-465a-3p miRNA Agomir
abx882949-01 5 nmol

Mouse mmu-miR-465a-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-465a-3p miRNA Agomir
abx882949-02 10 nmol

Mouse mmu-miR-465a-3p miRNA Agomir

Sign In for Pricing
View Details
OR2A12 sgRNA CRISPR Lentivector (Human) (Target 3)
K1490404 1.0 µg DNA

OR2A12 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Langya Virus Fusion Protein (F), N-His
VG9C351-01 1 mg

Recombinant Langya Virus Fusion Protein (F), N-His

Sign In for Pricing
View Details
Recombinant Langya Virus Fusion Protein (F), N-His
VG9C351-02 100 µg

Recombinant Langya Virus Fusion Protein (F), N-His

Sign In for Pricing
View Details
C9orf75 (TPRN) (NM_173691) Human 3' UTR Clone
SC206662 10 µg

C9orf75 (TPRN) (NM_173691) Human 3' UTR Clone

Sign In for Pricing
View Details