Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IGFBP-3 R / TMEM219 Protein, Fc Tag (MALS verified)
IGR-H5259-1mg 1 mg

Human IGFBP-3 R / TMEM219 Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details
FRAT2 (NM_012083) Human Tagged Lenti ORF Clone
RC202492L3 10 µg

FRAT2 (NM_012083) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-Human KIAA0196 pAb
PA12686-01 50 μL

Rabbit Anti-Human KIAA0196 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human KIAA0196 pAb
PA12686-02 100 μL

Rabbit Anti-Human KIAA0196 pAb

Sign In for Pricing
View Details
C6orf97 (CCDC170) Human shRNA Plasmid Kit (Locus ID 80129)
TG305776 1 Kit

C6orf97 (CCDC170) Human shRNA Plasmid Kit (Locus ID 80129)

Sign In for Pricing
View Details
80nm Carboxylated (carboxyl-PEG3000-SH) Silver Nanoparticles
SC3K-80-25 0.5 mL

80nm Carboxylated (carboxyl-PEG3000-SH) Silver Nanoparticles

Sign In for Pricing
View Details