Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C-Peptide ELISA Kit
SL0531Hu-01 48 Tests

Human C-Peptide ELISA Kit

Sign In for Pricing
View Details
Human C-Peptide ELISA Kit
SL0531Hu-02 96 Tests

Human C-Peptide ELISA Kit

Sign In for Pricing
View Details
Rfc4 ORF Vector (Rat) (pORF)
38854016 1.0 µg DNA

Rfc4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
DEAR1 Antibody
PHY7776S 150 μg

DEAR1 Antibody

Sign In for Pricing
View Details
ASB7 Antibody, Biotin conjugated
A67096-100UG 100 µg

ASB7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
BMS-303141
443077-01 5 mg

BMS-303141

Sign In for Pricing
View Details