Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM12 (NM_001198838) Human Untagged Clone
SC331227 10 µg

RBM12 (NM_001198838) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS7092621 Inquire

Recombinant Thermosynechococcus elongatus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Human PKD1 Pre-designed siRNA Set B
SI012236B 1 Each

Human PKD1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Secretory Leukocyte Peptidase Inhibitor (FITC)
549863 200 µL

Secretory Leukocyte Peptidase Inhibitor (FITC)

Sign In for Pricing
View Details
PKD1L2 Protein Vector (Human) (pPM-C-HA)
PV031495 500 ng

PKD1L2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse TGFB2 siRNA
abx936617-01 15 nmol

Mouse TGFB2 siRNA

Sign In for Pricing
View Details