Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGREF1 (CGR11, Cell Growth Regulator with EF Hand Domain Protein 1, Cell Growth Regulatory Gene 11 Protein, Hydrophobestin) (AP)
MBS6130565-01 0.1 mL

CGREF1 (CGR11, Cell Growth Regulator with EF Hand Domain Protein 1, Cell Growth Regulatory Gene 11 Protein, Hydrophobestin) (AP)

Sign In for Pricing
View Details
CGREF1 (CGR11, Cell Growth Regulator with EF Hand Domain Protein 1, Cell Growth Regulatory Gene 11 Protein, Hydrophobestin) (AP)
MBS6130565-02 5x 0.1 mL

CGREF1 (CGR11, Cell Growth Regulator with EF Hand Domain Protein 1, Cell Growth Regulatory Gene 11 Protein, Hydrophobestin) (AP)

Sign In for Pricing
View Details
CYP2R1 Polyclonal Antibody
ABP53682-01 30 µL

CYP2R1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP2R1 Polyclonal Antibody
ABP53682-02 100 µL

CYP2R1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP2R1 Polyclonal Antibody
ABP53682-03 200 µL

CYP2R1 Polyclonal Antibody

Sign In for Pricing
View Details
Toradol
M15828-01 1 g

Toradol

Sign In for Pricing
View Details