Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN23 Blocking Peptide
MBS9628416-01 1 mg

CLDN23 Blocking Peptide

Sign In for Pricing
View Details
CLDN23 Blocking Peptide
MBS9628416-02 5x 1 mg

CLDN23 Blocking Peptide

Sign In for Pricing
View Details
Lentiviral mouse Rnf26 shRNA (UAS) - Lentiviral mouse Rnf26 shRNA (UAS, GFP) plasmid
GTR15279214 1 Vial

Lentiviral mouse Rnf26 shRNA (UAS) - Lentiviral mouse Rnf26 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Itgad sgRNA CRISPR Lentivector set (Mouse)
K4282401 3x 1.0 µg

Itgad sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PDP2 (NM_020786) Human Tagged Lenti ORF Clone
RC207071L1 10 µg

PDP2 (NM_020786) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KRT8P9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1166708 1.0 µg DNA

KRT8P9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details