Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CABP4 Antibody (OTI9A7) [Alexa Fluor 594]
NBP2-72071AF594 0.1 mL

Mouse Monoclonal CABP4 Antibody (OTI9A7) [Alexa Fluor 594]

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_000162) Human Mutant ORF Clone
RC401294 10 µg

Glucokinase (GCK) (NM_000162) Human Mutant ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal BMPR-IB/ALK-6 Antibody (MM0055-3E12) [Alexa Fluor 700]
NBP2-12031AF700 0.1 mL

Mouse Monoclonal BMPR-IB/ALK-6 Antibody (MM0055-3E12) [Alexa Fluor 700]

Sign In for Pricing
View Details
Matrix Metalloproteinase 13 (MMP13) Magnetic Fluorescence Assay Kit
MBS2154769-01 96 Tests

Matrix Metalloproteinase 13 (MMP13) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Matrix Metalloproteinase 13 (MMP13) Magnetic Fluorescence Assay Kit
MBS2154769-02 5x 96 Tests

Matrix Metalloproteinase 13 (MMP13) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Matrix Metalloproteinase 13 (MMP13) Magnetic Fluorescence Assay Kit
MBS2154769-03 10x 96 Tests

Matrix Metalloproteinase 13 (MMP13) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details