Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E130306D19Rik 3'UTR GFP Stable Cell Line
TU155520 1.0 mL

E130306D19Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DDX28 (NM_018380) Human Untagged Clone
SC113527 10 µg

DDX28 (NM_018380) Human Untagged Clone

Sign In for Pricing
View Details
Itgb3bp sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3552402 1.0 µg DNA

Itgb3bp sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Tgfb2 3'UTR Luciferase Stable Cell Line
TU221824 1.0 mL

Tgfb2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
4-(Benzyloxy)-2-nitrophenol
MBS5824984 Inquire

4-(Benzyloxy)-2-nitrophenol

Sign In for Pricing
View Details
Vegfa Mouse qPCR Primer Pair (NM_001025250)
MP218181 200 Reactions

Vegfa Mouse qPCR Primer Pair (NM_001025250)

Sign In for Pricing
View Details