Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFA5 Protein Vector (Human) (pPM-C-HA)
PV012123 500 ng

DEFA5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Ubxn8 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4497302 1.0 µg DNA

Ubxn8 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MAPKAP Kinase 2 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62903R-PE-Cy7 100 µL

MAPKAP Kinase 2 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Sealing Mats
SLT-RD-9-PRT 50 Pack/Case

Sealing Mats

Sign In for Pricing
View Details
Defb18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6301806 1.0 µg DNA

Defb18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal Glypican 3 Antibody (GPC3/7991R) [DyLight 350]
NBP3-24202UV 0.1 mL

Rabbit Monoclonal Glypican 3 Antibody (GPC3/7991R) [DyLight 350]

Sign In for Pricing
View Details