Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42SE2 (NM_020240) Human Untagged Clone
SC108682 10 µg

CDC42SE2 (NM_020240) Human Untagged Clone

Sign In for Pricing
View Details
CCDC110 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0383406 1.0 µg DNA

CCDC110 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Zmynd11 ORF Vector (Rat) (pORF)
51285017 1.0 µg DNA

Zmynd11 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal NR4A3/NOR1 Antibody (OTI5C2) [Alexa Fluor 350]
NBP2-73052AF350 0.1 mL

Mouse Monoclonal NR4A3/NOR1 Antibody (OTI5C2) [Alexa Fluor 350]

Sign In for Pricing
View Details
RHBDL2 Polyclonal Antibody
MBS8569099-01 0.1 mL

RHBDL2 Polyclonal Antibody

Sign In for Pricing
View Details
RHBDL2 Polyclonal Antibody
MBS8569099-02 0.1 mL (AF405L)

RHBDL2 Polyclonal Antibody

Sign In for Pricing
View Details