Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf118 Protein Vector (Human) (pPM-C-HA)
PV049439 500 ng

C10orf118 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
PE/Cyanine5 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782G-01 20 Tests

PE/Cyanine5 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Cyanine5 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782G-02 100 Tests

PE/Cyanine5 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Cyanine5 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09782G-03 2x 100 Tests

PE/Cyanine5 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
HS014
HY-P1216 1 Each

HS014

Sign In for Pricing
View Details
Recombinant Human HOMER1 Protein
E30P6133 20 µg

Recombinant Human HOMER1 Protein

Sign In for Pricing
View Details