Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Labeling Kit
E-LK-E011A-01 3 Reactions

Elab Fluor® Red 780 Labeling Kit

Sign In for Pricing
View Details
Elab Fluor® Red 780 Labeling Kit
E-LK-E011A-02 10 Reactions

Elab Fluor® Red 780 Labeling Kit

Sign In for Pricing
View Details
Human Ribonuclease pancreatic, RNASE1 ELISA KIT
ELI-14517h 96 Tests

Human Ribonuclease pancreatic, RNASE1 ELISA KIT

Sign In for Pricing
View Details
FBXO30 Human shRNA Plasmid Kit (Locus ID 84085)
TR304557 1 Kit

FBXO30 Human shRNA Plasmid Kit (Locus ID 84085)

Sign In for Pricing
View Details
LDL Receptor (LDLR) polyclonal antibody
BS80363-01 50 µL

LDL Receptor (LDLR) polyclonal antibody

Sign In for Pricing
View Details
LDL Receptor (LDLR) polyclonal antibody
BS80363-02 100 µL

LDL Receptor (LDLR) polyclonal antibody

Sign In for Pricing
View Details