Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-PTEN Antibody
HY500002 0.1 mL

SensiStain™ Anti-PTEN Antibody

Sign In for Pricing
View Details
Vonoprazan Impurity 140
RM-V141740-01 10 mg

Vonoprazan Impurity 140

Sign In for Pricing
View Details
Vonoprazan Impurity 140
RM-V141740-02 25 mg

Vonoprazan Impurity 140

Sign In for Pricing
View Details
Vonoprazan Impurity 140
RM-V141740-03 50 mg

Vonoprazan Impurity 140

Sign In for Pricing
View Details
Vonoprazan Impurity 140
RM-V141740-04 100 mg

Vonoprazan Impurity 140

Sign In for Pricing
View Details
Rabbit Polyclonal DCTN5 Antibody
NBP2-57058-25ul 25 µL

Rabbit Polyclonal DCTN5 Antibody

Sign In for Pricing
View Details