Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cystatin A Antibody
NBP2-99328-50ul 50 µL

Rabbit Polyclonal Cystatin A Antibody

Sign In for Pricing
View Details
Formyl-Histone H2B type 2E (Lys109) Recombinant Antibody, FITC Conjugated
bsm-62329R-FITC-01 20 µL

Formyl-Histone H2B type 2E (Lys109) Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Formyl-Histone H2B type 2E (Lys109) Recombinant Antibody, FITC Conjugated
bsm-62329R-FITC-02 100 µL

Formyl-Histone H2B type 2E (Lys109) Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
LINC00276 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV731189 1.0 µg DNA

LINC00276 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ultrasonic Cleaner (BEV-802)
BEV-802 1 Unit

Ultrasonic Cleaner (BEV-802)

Sign In for Pricing
View Details
Lentiviral human ART5 shRNA (UAS) - Lentiviral human ART5 shRNA (UAS, RFP) (100)
GTR15153048 1 Vial

Lentiviral human ART5 shRNA (UAS) - Lentiviral human ART5 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details