Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS9 Antibody
A15340-100UG 100 µg

RPS9 Antibody

Sign In for Pricing
View Details
Gpr137c (NM_027518) Mouse Tagged ORF Clone Lentiviral Particle
MR213244L3V 200 µL

Gpr137c (NM_027518) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NUDT7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1464708 1.0 µg DNA

NUDT7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MCT-1 (Malignant T cell Amplified Sequence 1, MCTS1, Oncogene MCT-1)
M2757 100 µL

MCT-1 (Malignant T cell Amplified Sequence 1, MCTS1, Oncogene MCT-1)

Sign In for Pricing
View Details
P47-phox, phosphorylated (S328) discontinued
341415-01 100 µL

P47-phox, phosphorylated (S328) discontinued

Sign In for Pricing
View Details
P47-phox, phosphorylated (S328) discontinued
341415-02 200 µL

P47-phox, phosphorylated (S328) discontinued

Sign In for Pricing
View Details