AP-2 gamma/TFAP2C, Human (His)
The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html
Purity
96.0
Smiles
LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV
Molecular Formula
7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)
Molecular Weight
Approximately 10-14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse A930009A15Rik shRNA (UAS) - Lentiviral mouse A930009A15Rik shRNA (UAS) plasmid
NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (AP)
NCBP2 (Nuclear Cap-binding Protein Subunit 2, 20kD Nuclear Cap-binding Protein, NCBP 20kD Subunit, CBP20, NCBP-interacting Protein 1, NIP1, Cell Proliferation-inducing Gene 55 Protein, CBP20, PIG55) (AP)