Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP-2 gamma/TFAP2C, Human (His)

The AP-2 gamma/TFAP2C protein is a sequence-specific DNA-binding factor that complexly regulates gene transcription by binding to enhancer elements. It recognizes the consensus sequence 5'-GCCNNNGGC-3' and activates genes critical for multiple developmental functions. AP-2 gamma/TFAP2C Protein, Human (His) is the recombinant human-derived AP-2 gamma/TFAP2C protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

AP-2 gamma/TFAP2C Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ap-2-gamma-tfap2c-protein-human-his.html

Purity

96.0

Smiles

LSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEV

Molecular Formula

7022 (Gene_ID) Q92754-1 (L128-V223) (Accession)

Molecular Weight

Approximately 10-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX3
FP-144 100 µL - 10 Tests

PAX3

Sign In for Pricing
View Details
pCR-XL-TOPO-EIF4G1 Plasmid
PVT27414 2 µg

pCR-XL-TOPO-EIF4G1 Plasmid

Sign In for Pricing
View Details
Recombinant Human TNFSF13B/TNFSF20 (N-Fc)
32-9604-50 50 µg

Recombinant Human TNFSF13B/TNFSF20 (N-Fc)

Sign In for Pricing
View Details
Human recombinant ICAM-3/CD50 protein
PROTP32942-1-100ug 100 µg

Human recombinant ICAM-3/CD50 protein

Sign In for Pricing
View Details
Salicylic Acid-d4
TRC-S088127-250MG 250 mg

Salicylic Acid-d4

Sign In for Pricing
View Details
Rabbit Monoclonal Notch-2 Antibody (B6)
NBP2-62559 0.2 mg

Rabbit Monoclonal Notch-2 Antibody (B6)

Sign In for Pricing
View Details