Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Canine (HEK293)

VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGF164 Protein, Canine (HEK293) is the recombinant canine-derived VEGF164 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

VEGF164 Protein, Canine (HEK293), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegfa-protein-canine-hek293.html

Purity

95.0

Smiles

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

403802 (Gene_ID) Q9MYV3-3/NP_001103972.1 (A27-R190) (Accession)

Molecular Weight

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1123824-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1123824-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1123824-03 0.02 mg (Yeast)

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1123824-04 0.1 mg (Yeast)

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1123824-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)
MBS1123824-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O139:H28 Orotidine 5'-phosphate decarboxylase (pyrF)

Sign In for Pricing
View Details