Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Canine (HEK293)

VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGF164 Protein, Canine (HEK293) is the recombinant canine-derived VEGF164 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

VEGF164 Protein, Canine (HEK293), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegfa-protein-canine-hek293.html

Purity

95.0

Smiles

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

403802 (Gene_ID) Q9MYV3-3/NP_001103972.1 (A27-R190) (Accession)

Molecular Weight

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Magnetic Fluorescence Assay Kit
MBS2160376-01 96 Tests

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Small Ubiquitin Related Modifier Protein 1 (SUMO1) Magnetic Fluorescence Assay Kit
MBS2160376-02 5x 96 Tests

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Small Ubiquitin Related Modifier Protein 1 (SUMO1) Magnetic Fluorescence Assay Kit
MBS2160376-03 10x 96 Tests

Small Ubiquitin Related Modifier Protein 1 (SUMO1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
PRR2 Antibody
orb793347 2 mg

PRR2 Antibody

Sign In for Pricing
View Details
METAP2 Peptide
orb2013903 100 µg

METAP2 Peptide

Sign In for Pricing
View Details
NGFR p75 (NGFR, TNFRSF16, Tumor necrosis factor receptor superfamily member 16, Gp80-LNGFR, Low affinity neurotrophin receptor p75NTR, Low-affinity nerve growth factor receptor, NGF receptor, p75 ICD, CD antigen CD271)
325566 100 µL

NGFR p75 (NGFR, TNFRSF16, Tumor necrosis factor receptor superfamily member 16, Gp80-LNGFR, Low affinity neurotrophin receptor p75NTR, Low-affinity nerve growth factor receptor, NGF receptor, p75 ICD, CD antigen CD271)

Sign In for Pricing
View Details