Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Canine (HEK293)

VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGF164 Protein, Canine (HEK293) is the recombinant canine-derived VEGF164 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

VEGF164 Protein, Canine (HEK293), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegfa-protein-canine-hek293.html

Purity

95.0

Smiles

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

403802 (Gene_ID) Q9MYV3-3/NP_001103972.1 (A27-R190) (Accession)

Molecular Weight

Approximately 20-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDRF1 (C10orf137, Erythroid Differentiation-related Factor 1)
126163 50 µg

EDRF1 (C10orf137, Erythroid Differentiation-related Factor 1)

Sign In for Pricing
View Details
MMD siRNA (Rat)
orb1829053-01 15 nmol

MMD siRNA (Rat)

Sign In for Pricing
View Details
MMD siRNA (Rat)
orb1829053-02 30 nmol

MMD siRNA (Rat)

Sign In for Pricing
View Details
Rabbit Anti Human PBOV1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul
IRBAHUPBOV1AP415120UL 120 µL

Rabbit Anti Human PBOV1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul

Sign In for Pricing
View Details
CLEC4D (NM_080387) Human Over-expression Lysate
LS338339-20ug 20 µg

CLEC4D (NM_080387) Human Over-expression Lysate

Sign In for Pricing
View Details
2- (4-Chlorophenoxy) aniline
orb3029469-01 1 g

2- (4-Chlorophenoxy) aniline

Sign In for Pricing
View Details