Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gasdermin-A (GSDMA)

Product Specifications

Product Name Alternative

Gasdermin-1; GSDMA-NT; GSDMA-CT

Abbreviation

Recombinant Human GSDMA protein

Gene Name

GSDMA

UniProt

Q96QA5

Expression Region

1-445aa

Organism

Homo sapiens (Human)

Target Sequence

MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

This form constitutes the precursor of the pore-forming protein: upon cleavage, the released N-terminal moiety (Gasdermin-A, N-terminal) binds to membranes and forms pores, triggering cell death. ; [Gasdermin-A, N-terminal]: Pore-forming protein that causes membrane permeabilization and pyroptosis. Released upon cleavage in vitro of genetically engineered GSDMA, and binds to membrane inner leaflet lipids. Homooligomerizes within the membrane and forms pores of 10-15 nanometers (nm) of inner diameter, triggering pyroptosis. Binds to membrane inner leaflet lipids, such as phosphatidylinositol (4,5) -bisphosphate. The functional mechanisms and physiological proteases that cleave and activate this pore-forming protein are unknown.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DCUN1D1 activation kit by CRISPRa
GA110070 1 Kit

Human DCUN1D1 activation kit by CRISPRa

Sign In for Pricing
View Details
Nestin Recombinant Chimeric Antibody Antibody
HA610302 100 µg

Nestin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
CD28 (204.12), Biotin conjugate, 0.1mg/mL
BNCB0164-100 1x 100 µL

CD28 (204.12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mature Neuron Marker Antibody Kit
HAK21007 1 Kit

Mature Neuron Marker Antibody Kit

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG
12750-35.1G 1 g

Ɑ-Methoxy-ω-Succinamic Acid NHS Ester PEG

Sign In for Pricing
View Details
QuantiFluo™ α-Amylase Inhibitor Screening Kit
IAMY-400 400 Tests

QuantiFluo™ α-Amylase Inhibitor Screening Kit

Sign In for Pricing
View Details