Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Cys (Cy5) ] - (Fluorescent Peptides)

Product Specifications

Sequence

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (C/Cy5) -OH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV688239 1.0 µg DNA

ADAMTS4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)
MBS1305626-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)
MBS1305626-02 0.02 mg (Yeast)

Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)
MBS1305626-03 0.1 mg (E-Coli)

Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)
MBS1305626-04 0.1 mg (Yeast)

Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)
MBS1305626-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhimurium Secreted effector protein sseI (sseI)

Sign In for Pricing
View Details