Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glucagon (1-29) -[Cys (Cy5) ] - (Fluorescent Peptides)

Product Specifications

Sequence

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT (C/Cy5) -OH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) PYRH Polyclonal Antibody
MBS7165110 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) PYRH Polyclonal Antibody

Sign In for Pricing
View Details
beta Tubulin Recombinant Protein Antigen
NBP2-54728PEP 0.1 mL

beta Tubulin Recombinant Protein Antigen

Sign In for Pricing
View Details
C15orf63 Protein Vector (Human) (pPB-His-GST)
PV329071 500 ng

C15orf63 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Retinol Binding Protein 4 (RBP4)
MBS2131952-01 0.1 mL

Biotin Linked Monoclonal Antibody to Retinol Binding Protein 4 (RBP4)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Retinol Binding Protein 4 (RBP4)
MBS2131952-02 0.2 mL

Biotin Linked Monoclonal Antibody to Retinol Binding Protein 4 (RBP4)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Retinol Binding Protein 4 (RBP4)
MBS2131952-03 0.5 mL

Biotin Linked Monoclonal Antibody to Retinol Binding Protein 4 (RBP4)

Sign In for Pricing
View Details