Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 [Lys (AF647) ] - (Fluorescent Peptides)

Product Specifications

Sequence

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (K/AF647 DBCO) -NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (FITC)

MBS6452260-01 0.1 mL

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (FITC)

Sign In for Pricing

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (FITC)

MBS6452260-02 5x 0.1 mL

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (FITC)

Sign In for Pricing

Stx1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

K7555607 1.0 µg DNA

Stx1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing

Rnft2 (NM_172998) Mouse Tagged Lenti ORF Clone

MR205411L3 10 µg

Rnft2 (NM_172998) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

Mouse Chibby Homolog 1 (CBY1) Antibody Pair Kit (with Standard)

MBS2101591-01 5x 96 Tests

Mouse Chibby Homolog 1 (CBY1) Antibody Pair Kit (with Standard)

Sign In for Pricing

Mouse Chibby Homolog 1 (CBY1) Antibody Pair Kit (with Standard)

MBS2101591-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Chibby Homolog 1 (CBY1) Antibody Pair Kit (with Standard)

Sign In for Pricing