Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 [Lys (AF647) ] - (Fluorescent Peptides)

Product Specifications

Sequence

H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (K/AF647 DBCO) -NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata24 Double Nickase Plasmid (m2)
sc-427909-NIC-2 20 µg

Spata24 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Phospho-MEK6 (Ser207) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-3275R-BF405 100 µL

Phospho-MEK6 (Ser207) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
FNDC4 Rabbit pAb, PerCP-Cy7 conjugated
orb2880053 100 µL

FNDC4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human SPIN1 Protein
ARP4000-01 10 µg

Recombinant Human SPIN1 Protein

Sign In for Pricing
View Details
Recombinant Human SPIN1 Protein
ARP4000-02 50 µg

Recombinant Human SPIN1 Protein

Sign In for Pricing
View Details
Recombinant Human SPIN1 Protein
ARP4000-03 100 µg

Recombinant Human SPIN1 Protein

Sign In for Pricing
View Details