Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gp96-II - (Immunology - Antigens/Epitotes/Pools/Librairies)

Product Specifications

Sequence

H-LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-OH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(3-Hydroxyphenyl)propionic Acid
TRC-H940090-1G 1 g

3-(3-Hydroxyphenyl)propionic Acid

Sign In for Pricing
View Details
Dextran (Technical Grade~ 60K)
TRC-D299125-25G 25 g

Dextran (Technical Grade~ 60K)

Sign In for Pricing
View Details
Mouse Htr3b activation kit by CRISPRa
GA206124 1 Kit

Mouse Htr3b activation kit by CRISPRa

Sign In for Pricing
View Details
ANKRD16 (NM_001009943) Human Over-expression Lysate
LY423161 100 µg

ANKRD16 (NM_001009943) Human Over-expression Lysate

Sign In for Pricing
View Details
Zc2hc1c Rabbit Polyclonal Antibody
TA363550 100 µL

Zc2hc1c Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Meter™ Fixed Cell and Tissue TUNEL Apoptosis Assay Kit *Deep Red Fluorescence*
22855-AAT 25 Tests

Cell Meter™ Fixed Cell and Tissue TUNEL Apoptosis Assay Kit *Deep Red Fluorescence*

Sign In for Pricing
View Details