Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (Pro 3) - (Hormones)

Product Specifications

Sequence

H-YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC13, ID (SEC13, D3S1231E, SEC13L1, SEC13R, Protein SEC13 homolog, SEC13-like protein 1, SEC13-related protein) (MaxLight 650) discontinued
041507-ML650 100 µL

SEC13, ID (SEC13, D3S1231E, SEC13L1, SEC13R, Protein SEC13 homolog, SEC13-like protein 1, SEC13-related protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Hydrocortisone Impurity 74
RM-H040374-01 10 mg

Hydrocortisone Impurity 74

Sign In for Pricing
View Details
Hydrocortisone Impurity 74
RM-H040374-02 25 mg

Hydrocortisone Impurity 74

Sign In for Pricing
View Details
Hydrocortisone Impurity 74
RM-H040374-03 50 mg

Hydrocortisone Impurity 74

Sign In for Pricing
View Details
Hydrocortisone Impurity 74
RM-H040374-04 100 mg

Hydrocortisone Impurity 74

Sign In for Pricing
View Details
RNF123 Double Nickase Plasmid (m2)
sc-429979-NIC-2 20 µg

RNF123 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details