Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (Pro 3) - (Hormones)

Product Specifications

Sequence

H-YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ARID1B Antibody
NBP1-89358-25ul 25 µL

Rabbit Polyclonal ARID1B Antibody

Sign In for Pricing
View Details
R- (-) -α-Naphthyl Glycidyl Ether
018015 500 mg

R- (-) -α-Naphthyl Glycidyl Ether

Sign In for Pricing
View Details
Gremlin 2, human recombinant
4657-20 20 µg

Gremlin 2, human recombinant

Sign In for Pricing
View Details
2-[2- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) ethyl]-4-methyl-1,3-thiazole-5-carboxylic acid
SID50101-01 50 mg

2-[2- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) ethyl]-4-methyl-1,3-thiazole-5-carboxylic acid

Sign In for Pricing
View Details
2-[2- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) ethyl]-4-methyl-1,3-thiazole-5-carboxylic acid
SID50101-02 0.5 g

2-[2- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl}amino) ethyl]-4-methyl-1,3-thiazole-5-carboxylic acid

Sign In for Pricing
View Details
Glycolaldehyde Dimer
OR1013430-01 5 g

Glycolaldehyde Dimer

Sign In for Pricing
View Details