Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (Pro 3) - (Hormones)

Product Specifications

Sequence

H-YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROCK1 Conjugated Antibody
C48890 100 µL

ROCK1 Conjugated Antibody

Sign In for Pricing
View Details
ECM2 ORF Vector (Human) (pORF)
ORF018674 1.0 µg DNA

ECM2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 Antibody
DF14459-01 100 µL

Lymphocyte Activation Gene 3 Antibody

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 Antibody
DF14459-02 200 µL

Lymphocyte Activation Gene 3 Antibody

Sign In for Pricing
View Details
Rabbit Anti Human SLC52A1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAHUSLC52A1AP470120UL 120 µL

Rabbit Anti Human SLC52A1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
Recombinant Salmonella dublin Phosphoenolpyruvate carboxylase (ppc), partial
MBS1155728 Inquire

Recombinant Salmonella dublin Phosphoenolpyruvate carboxylase (ppc), partial

Sign In for Pricing
View Details