Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3.2 (1-44) - (Histone Peptides)

Product Specifications

Sequence

H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Syntaxin 18 (STX18) ELISA Kit
abx259868 96 Tests

Human Syntaxin 18 (STX18) ELISA Kit

Sign In for Pricing
View Details
SLC2A3 Antibody
MBS7130340-01 0.1 mL

SLC2A3 Antibody

Sign In for Pricing
View Details
SLC2A3 Antibody
MBS7130340-02 5x 0.1 mL

SLC2A3 Antibody

Sign In for Pricing
View Details
Human SCML2 Protein Lysate 20ug
IHUSCML2PLLY20UG 20 µg

Human SCML2 Protein Lysate 20ug

Sign In for Pricing
View Details
AS3MT Protein Vector (Mouse) (pPB-N-His)
PV156543 500 ng

AS3MT Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
P2RX7 (P2X Purinoceptor 7, Purinergic Receptor P2X, Ligand-gated Ion Channel, 7)
487925 100 µL

P2RX7 (P2X Purinoceptor 7, Purinergic Receptor P2X, Ligand-gated Ion Channel, 7)

Sign In for Pricing
View Details