Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3.2 (1-44) - (Histone Peptides)

Product Specifications

Sequence

H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BECN1 Knockout Cell Lysate
ABC-KC0194 100 µg

BECN1 Knockout Cell Lysate

Sign In for Pricing
View Details
ART5 Polyclonal Antibody, FITC Conjugated
bs-9105R-FITC 100 µL

ART5 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-ROMK1 (pS44) Antibody
MBS8605420-01 0.1 mg

Anti-ROMK1 (pS44) Antibody

Sign In for Pricing
View Details
Anti-ROMK1 (pS44) Antibody
MBS8605420-02 0.1 mL (AF635)

Anti-ROMK1 (pS44) Antibody

Sign In for Pricing
View Details
Anti-ROMK1 (pS44) Antibody
MBS8605420-03 0.1 mL (AF610)

Anti-ROMK1 (pS44) Antibody

Sign In for Pricing
View Details
Anti-ROMK1 (pS44) Antibody
MBS8605420-04 0.1 mL (AF405S)

Anti-ROMK1 (pS44) Antibody

Sign In for Pricing
View Details