Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3.2 (1-44) - (Histone Peptides)

Product Specifications

Sequence

H-ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG-OH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPG2 Protein Vector (Mouse) (pPM-C-His)

PV191721 500 ng

IMPG2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing

Lentiviral mouse Vmn1r191 shRNA (UAS) - Lentiviral mouse Vmn1r191 shRNA (UAS, RFP) (100)

GTR15181260 1 Vial

Lentiviral mouse Vmn1r191 shRNA (UAS) - Lentiviral mouse Vmn1r191 shRNA (UAS, RFP) (100)

Sign In for Pricing

Mouse Monoclonal EGLN3/PHD3 Antibody (EG188e/d5) [Alexa Fluor 700]

NBP1-30440AF700 0.2 mL

Mouse Monoclonal EGLN3/PHD3 Antibody (EG188e/d5) [Alexa Fluor 700]

Sign In for Pricing

COX6c HDR Plasmid (m)

sc-419770-HDR 20 µg

COX6c HDR Plasmid (m)

Sign In for Pricing

ZNF707 Antibody, Biotin conjugated

A39162-50UG 50 µg

ZNF707 Antibody, Biotin conjugated

Sign In for Pricing

Lentiviral mouse Shmt1 shRNA (UAS) - Lentiviral mouse Shmt1 shRNA (UAS, iRFP) (25)

GTR15181478 1 Vial

Lentiviral mouse Shmt1 shRNA (UAS) - Lentiviral mouse Shmt1 shRNA (UAS, iRFP) (25)

Sign In for Pricing