Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP (1-42) -[C] human - (Hormones)

Product Specifications

Sequence

H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB37 activation kit by CRISPRa
GA117331 1 Kit

Human RAB37 activation kit by CRISPRa

Sign In for Pricing
View Details
VGLL2 (N-term) Rabbit Polyclonal Antibody
AP54511PU-N 400 µL

VGLL2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AKAP13 Rabbit Polyclonal Antibody
AP01177PU-N 100 µg

AKAP13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
T7 Goat Polyclonal Antibody
AB0126-100 300 µg

T7 Goat Polyclonal Antibody

Sign In for Pricing
View Details
CD46 (197-2B1), CF488A conjugate, 0.1mg/mL
BNC880931-500 1x 500 µL

CD46 (197-2B1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FUBP3 Antibody
8C15743-AAT 50 µg

FUBP3 Antibody

Sign In for Pricing
View Details